Recombinant Streptococcus pneumoniae (strain P1031) ldh protein(1-328aa), His&Myc-tagged
| Cat.No. : | ldh-7548S |
| Product Overview : | Recombinant Streptococcus pneumoniae (strain P1031) ldh protein(C1CKW1)(1-328aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Streptococcus pneumoniae |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-328aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MTSTKQHKKVILVGDGAVGSSYAFALVNQGIAQELGIIEIPQLHEKAVGDALDLSHALAFTSPKKIYAAQYSDCADADLVVITAGAPQKPGETRLDLVGKNLAINKSIVTQVVESGFKGIFLVAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSARFRQALAEKLDVDARSVHAYIMGEHGDSEFAVWSHANIAGVNLEEFLKDTQNVQEAELIELFEGVRDAAYTIINKKGATYYGIAVALARITKAILDDENAVLPLSVFQEGQYGVENVFIGQPAVVGAHGIVRPVNIPLNDAETQKMQASAKELQAIIDEAWKNPEFQEASKN |
| ◆ Recombinant Proteins | ||
| ldh-1632B | Recombinant Bacillus cereus ldh Protein (Thr2-Arg366), His tagged | +Inquiry |
| ldh-632L | Recombinant Lactobacillus casei ldh protein, His-tagged | +Inquiry |
| ldh-7548S | Recombinant Streptococcus pneumoniae (strain P1031) ldh protein(1-328aa), His&Myc-tagged | +Inquiry |
| LDH-0124P | Recombinant Plasmodium vivax LDH antigen | +Inquiry |
| LDH-71P | Recombinant Po LDH Protein | +Inquiry |
| ◆ Native Proteins | ||
| LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
| LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
| LDH-17H | Active Native Human Lactate Dehydrogenase | +Inquiry |
| LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
| LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ldh Products
Required fields are marked with *
My Review for All ldh Products
Required fields are marked with *
