Recombinant Swine TNF alpha

Cat.No. : TNFa-24S
Product Overview : Swine TNF alpha was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : Yeast
Tag : Non
Description : Tumor necrosis factor alpha (TNFSF2) is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.
Form : Lyophilized
Molecular Mass : 16.9 kDa
AA Sequence : SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTH TISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFG IIAL
Applications : The Swine TNF alpha protein can be used in cell culture, as an TNF alpha ELISA Standard, and as a Western Blot
Storage : -20 C

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFa Products

Required fields are marked with *

My Review for All TNFa Products

Required fields are marked with *

0
cart-icon