Recombinant Terciopelo BaP1 protein(192-394aa), His&Myc-tagged
Cat.No. : | BaP1-769T |
Product Overview : | Recombinant Terciopelo BaP1 protein(P83512)(192-394aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Terciopelo |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 192-394aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QQRFSPRYIELAVVADHGIFTKYNSNLNTIRTRVHEMLNTVNGFYRSVDVHAPLANLEVWSKQDLIKVQKDSSKTLKSFGEWRERDLLPRISHDHAQLLTAVVFDGNTIGRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNLGIHHDTGSCSCGAKSCIMASVLSKVLSYEFSDCSQNQYETYLTNHNPQCILNKP |
◆ Recombinant Proteins | ||
BAP1-1813HF | Recombinant Full Length Human BAP1 Protein, GST-tagged | +Inquiry |
BAP1-167H | Active Recombinant Human BAP1 protein, His-tagged | +Inquiry |
BAP1-1090H | Recombinant Human BAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BAP1-7562Z | Recombinant Zebrafish BAP1 | +Inquiry |
BAP1-2290M | Recombinant Mouse BAP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAP1-8515HCL | Recombinant Human BAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BaP1 Products
Required fields are marked with *
My Review for All BaP1 Products
Required fields are marked with *
0
Inquiry Basket