Recombinant Torpedo Californica CHRNA1 Protein (25-234 aa), His-SUMO-tagged
Cat.No. : | CHRNA1-407T |
Product Overview : | Recombinant Torpedo Californica CHRNA1 Protein (25-234 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Torpedo Californica |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-234 aa |
Description : | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.8 kDa |
AA Sequence : | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P02710 |
◆ Recombinant Proteins | ||
Chrna1-778R | Recombinant Rat Chrna1 Protein, His-tagged | +Inquiry |
CHRNA1-1047R | Recombinant Rat CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA1-1472P | Recombinant Pacific electric ray CHRNA1 protein, His-tagged | +Inquiry |
CHRNA1-30388TH | Recombinant Human CHRNA1 | +Inquiry |
CHRNA1-1389R | Recombinant Rat CHRNA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
0
Inquiry Basket