Recombinant Vaccinia virus (strain Copenhagen) A27L protein, His&Myc-tagged
Cat.No. : | A27L-2279V |
Product Overview : | Recombinant Vaccinia virus (strain Copenhagen) A27L protein(P20535)(1-110aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.6 kDa |
AA Sequence : | MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
A27L-2425V | Recombinant Vaccinia Virus A27L Protein (1-110 aa), His-Myc-tagged | +Inquiry |
A27L-3679V | Recombinant Variola virus A27L protein, His-tagged | +Inquiry |
A27L-2443V | Recombinant Variola Virus A27L Protein (1-110 aa), His-tagged | +Inquiry |
A27L-5615V | Recombinant Vaccinia virus A27L protein, His-sumostar-tagged | +Inquiry |
A27L-4352V | Recombinant Vaccinia virus (strain WR 65-16) A27L protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A27L Products
Required fields are marked with *
My Review for All A27L Products
Required fields are marked with *