Recombinant Vibrio Cholerae Serotype O1 CTXB Protein (22-124 aa), His-tagged
Cat.No. : | CTXB-2270V |
Product Overview : | Recombinant Vibrio Cholerae Serotype O1 (strain ATCC 39315/El Tor Inaba N16961) CTXB Protein (22-124 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Cholerae Serotype O1 |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-124 aa |
Description : | The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.6 kDa |
AA Sequence : | TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | ctxB; |
UniProt ID | P01556 |
◆ Native Proteins | ||
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTXB Products
Required fields are marked with *
My Review for All CTXB Products
Required fields are marked with *
0
Inquiry Basket