Recombinant VSIV(strain 98COE North America) Matrix protein, His-Myc-tagged

Cat.No. : Matrix-790V
Product Overview : Recombinant VSIV(strain 98COE North America) Matrix protein(Q8B0I2)(1-229aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : VSIV(strain 98COE North America)
Source : E.coli
Tag : His&Myc
Protein Length : 1-229aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.5 kDa
AA Sequence : MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Matrix Products

Required fields are marked with *

My Review for All Matrix Products

Required fields are marked with *

0
cart-icon