Recombinant Yellow Fluorescent Protein

Cat.No. : YFP-007E
Product Overview : The recombinant YFP (Yellow Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal YFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications. The protein is a 26.4 kDa monomer with 238 amino acids, Ex./Em. = 525/538 nm, extinction coefficient 27390.
Fluorescent protein ideal for subcellular labeling/visualization
Availability July 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : Non
Description : Yellow fluorescent protein (YFP) is a genetic mutant of green fluorescent protein (GFP) originally derived from the jellyfish Aequorea victoria. Its excitation peak is 514 nm and its emission peak is 527 nm. Like the parent GFP, YFP is a useful tool in cell and molecular biology thanks to its properties useful for fluorescence microscopy.
Form : Lyophilized (Freeze Dried)
Molecular Mass : 26.4 kDa
AA Sequence : MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYL
Endotoxin : <0.1 ng/μg
Purity : ≥97%
Applications : The protein is suitable as control reagent for YFP expression studies or as labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of YFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of YFP into cells and tissues, etc. The recombinant YFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP and RFP.
Usage : For Research Use Only! Not to be used in humans
Storage : At -20 centigrade.
At -80 centigrade for long-term storage.
Reconstitution : Reconstitute with dH₂O to 1 mg/mL
Handling : Centrifuge the vial prior to opening.
Synonyms YFP, Yellow Fluorescent Protein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YFP Products

Required fields are marked with *

My Review for All YFP Products

Required fields are marked with *

0
cart-icon