Recombinant Yellow Fluorescent Protein, His-tagged
| Cat.No. : | YFP-149 |
| Product Overview : | Recombinant Yellow Fluorescent Protein, fused to His-tag, was expressed in HEK293. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Form : | Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH 8.5. |
| Molecular Mass : | The protein has a calculated MW of 27.4 kDa. |
| AA Sequence : | MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH |
| Purity : | >90%,by SDS-PAGE |
| Storage : | For long term storage, the product should be stored at lyophilized state at -20ºC or lower. Please avoid repeated freeze-thaw cycles. |
| Concentration : | 8.7mg/mL |
| ◆ Recombinant Proteins | ||
| YFP-02 | Recombinant YFP Protein | +Inquiry |
| YFP-149 | Recombinant Yellow Fluorescent Protein, His-tagged | +Inquiry |
| YFP-007E | Recombinant Yellow Fluorescent Protein | +Inquiry |
| YFP-01 | Recombinant Yellow Fluorescent Protein | +Inquiry |
| YFP-10 | Recombinant Yellow Fluorescent Protein | +Inquiry |
| ◆ Native Proteins | ||
| YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YFP Products
Required fields are marked with *
My Review for All YFP Products
Required fields are marked with *
