Recombinant Yellow Fluorescent Protein, His-tagged
Cat.No. : | YFP-149 |
Product Overview : | Recombinant Yellow Fluorescent Protein, fused to His-tag, was expressed in HEK293. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
Form : | Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH 8.5. |
Molecular Mass : | The protein has a calculated MW of 27.4 kDa. |
AA Sequence : | MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH |
Purity : | >90%,by SDS-PAGE |
Storage : | For long term storage, the product should be stored at lyophilized state at -20ºC or lower. Please avoid repeated freeze-thaw cycles. |
Concentration : | 8.7mg/mL |
◆ Recombinant Proteins | ||
YFP-02 | Recombinant YFP Protein | +Inquiry |
YFP-149 | Recombinant Yellow Fluorescent Protein, His-tagged | +Inquiry |
YFP-01 | Recombinant Yellow Fluorescent Protein | +Inquiry |
YFP-10 | Recombinant Yellow Fluorescent Protein | +Inquiry |
YFP-007E | Recombinant Yellow Fluorescent Protein | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YFP Products
Required fields are marked with *
My Review for All YFP Products
Required fields are marked with *
0
Inquiry Basket