Recombinant YFP Protein
Cat.No. : | YFP-02 |
Product Overview : | The recombinant YFP (Yellow Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal YFP fluorescence.Endotoxin has been removed. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | Non |
Description : | The protein is a 26.4 kDa monomer with 238 amino acids, Ex./Em. = 525/538 nm, extinction coefficient 27390. |
Form : | Freeze Dried |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTIT FEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEY HHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYL |
Endotoxin : | <0.1 |
Purity : | Greater than 97% by SDS-PAGE and HPLC |
Applications : | The protein is suitable for in vivo injection or cell culture applications. |
Storage : | -20°C |
Reconstitution : | Reconstitute with dH?O to 1 mg/ml |
◆ Recombinant Proteins | ||
YFP-007E | Recombinant Yellow Fluorescent Protein | +Inquiry |
YFP-149 | Recombinant Yellow Fluorescent Protein, His-tagged | +Inquiry |
YFP-10 | Recombinant Yellow Fluorescent Protein | +Inquiry |
YFP-02 | Recombinant YFP Protein | +Inquiry |
YFP-01 | Recombinant Yellow Fluorescent Protein | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YFP Products
Required fields are marked with *
My Review for All YFP Products
Required fields are marked with *