Recombinant Zebrafish IFN gamma 1 Protein, 146
| Cat.No. : | IFNG-13Z |
| Product Overview : | Zebrafish IFN gamma 1-1 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | Yeast |
| Description : | Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
| Molecular Mass : | 17.4 kDa |
| AA Sequence : | YRFRRSRSENPILNTNIEKLKTHYNTLAKDWVGKSVFVSHLDQLNSKPTCTCQAVLLEGMLSIYEDIFQDMMNKSDNKEVRDDLKKVIHEVKNLKHKYNEEHKLWRELQDIHSVKAKNGTIQERALNDFLKVYYRASTEKRHLHMS |
| Applications : | The zebrafish IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
| Official Symbol | IFNG |
| Synonyms | IFNG; IFN gamma 1-1 |
| ◆ Recombinant Proteins | ||
| IFNG-119H | Recombinant Active Human IFNG Protein, His-tagged(C-ter) | +Inquiry |
| IFNG-1165C | Active Recombinant Cynomolgus IFNG Protein | +Inquiry |
| IFNG-804S | Recombinant Sheep IFNG protein, His-tagged | +Inquiry |
| IFNG-21H | Active Recombinant Human IFNG Protein, Animal Free | +Inquiry |
| IFNG-1184H | Recombinant Human IFNG Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
| IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
| IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
| IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
