Active GMP Recombinant Human IL11 protein
| Cat.No. : | IL11-4326HG |
| Product Overview : | Recombinant Human IL11 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
| Availability | December 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | Interleukin-11 (IL-11) is encoded by the IL11 gene and is a member of IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. It is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. The functions of IL-11 are that it directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induces megakaryocyte maturation resulting in increased platelet production. |
| Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine B9-11 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg. |
| Molecular Mass : | Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids. |
| AA Sequence : | MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Endotoxin : | Less than 1 EU/µg of rHuIL-11 as determined by LAL method. |
| Purity : | > 95 % by SDS-PAGE and HPLC analyses. |
| Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name | IL11 interleukin 11 [ Homo sapiens ] |
| Official Symbol | IL11 |
| Synonyms | IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11; |
| Gene ID | 3589 |
| mRNA Refseq | NM_000641 |
| Protein Refseq | NP_000632 |
| MIM | 147681 |
| UniProt ID | P20809 |
| ◆ Recombinant Proteins | ||
| Il11-842M | Recombinant Mouse Il11 protein(Pro22-Leu199) | +Inquiry |
| IL11-325H | Active Recombinant Human IL11 | +Inquiry |
| IL11-416H | Active Recombinant Human Interleukin-11 | +Inquiry |
| Il11-138M | Recombinant Active Mouse IL11 Protein, His-tagged(N-ter) | +Inquiry |
| IL11-123H | Recombinant Human IL11 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
04/10/2025
Yes, your products have been working so well. I am planning to place a small order in May (about 5 vials of IL11-4326H) but later we will be placing larger orders during the year. - Customer from @garudatx
Ask a Question for All IL11 Products
Required fields are marked with *
My Review for All IL11 Products
Required fields are marked with *
