Active GMP Recombinant Human IL11 protein

Cat.No. : IL11-4326HG
Product Overview : Recombinant Human IL11 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Interleukin-11 (IL-11) is encoded by the IL11 gene and is a member of IL-6 superfamily, distinguished based on their use of the common co-receptor gp130. It is a multifunctional cytokine first isolated from bone marrow-derived stromal cells. IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11Rα subunit and two molecules of the expressed cell signaling β subunit, gp130. The functions of IL-11 are that it directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells, and induces megakaryocyte maturation resulting in increased platelet production.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine B9-11 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10^6 IU/mg.
Molecular Mass : Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids.
AA Sequence : MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Endotoxin : Less than 1 EU/µg of rHuIL-11 as determined by LAL method.
Purity : > 95 % by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution : Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement : Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name IL11 interleukin 11 [ Homo sapiens ]
Official Symbol IL11
Synonyms IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11;
Gene ID 3589
mRNA Refseq NM_000641
Protein Refseq NP_000632
MIM 147681
UniProt ID P20809

Not For Human Consumption!

Inquiry

  • Reviews (1)
  • Q&As (0)

Customer Reviews

Write a review
Reviews
04/10/2025
IL11-4326HG

Yes, your products have been working so well. I am planning to place a small order in May (about 5 vials of IL11-4326H) but later we will be placing larger orders during the year. - Customer from @garudatx

Ask a Question for All IL11 Products

Required fields are marked with *

My Review for All IL11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon