Active GMP Recombinant Human IL7 Protein
Cat.No. : | IL7-151HG |
Product Overview : | Recombinant Human IL7 (Asp26-His177) with a 6His tag at the C-terminus was produced in HEK293 cell in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 26-177 a.a. |
Description : | Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction. |
Form : | Lyophilized. |
Bio-activity : | 2x10^6U/mg |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQ FLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCF LKRLLQEIKTCWNKILMGTKEHVDHHHHHH |
Residual Host Cell DNA Content : | <10pg/mg |
Residual Host Cell Protein Content : | <1ug/mg |
Endotoxin : | <0.1EU/ug |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Usage : | Recommemnd working concentration: 40ng/ml |
Storage : | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7 |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
Il7-233I | Active Recombinant Mouse Il7 Protein, His-tagged | +Inquiry |
IL7-3302C | Recombinant Chicken IL7 | +Inquiry |
IL7-1056H | Recombinant Human IL7 Protein, His-tagged | +Inquiry |
Il7-767M | Active Recombinant Mouse Il7 protein | +Inquiry |
IL7-187H | Active Recombinant Human IL7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *