Active GMP Recombinant Mouse Ccl4 Protein, His-Tagged

Cat.No. : Ccl4-01M
Product Overview : GMP Recombinant Mouse Ccl4 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system; genitourinary system; and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).
Form : Lyophilized
Bio-activity : Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <4 ng/mL.
AA Sequence : APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Ccl4 chemokine (C-C motif) ligand 4 [ Mus musculus (house mouse) ]
Official Symbol Ccl4
Synonyms Act-2; Mip1b; Scya4; MIP-1B; AT744.1
Gene ID 20303
mRNA Refseq NM_013652.2
Protein Refseq NP_038680.1
UniProt ID P14097

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl4 Products

Required fields are marked with *

My Review for All Ccl4 Products

Required fields are marked with *

0
cart-icon
0
compare icon