Active GMP Recombinant Mouse Csf2 Protein, His-Tagged

Cat.No. : Csf2-01M
Product Overview : GMP Recombinant Mouse Csf2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2)
Form : Lyophilized
Bio-activity : Measure by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2x 10^7 IU/mg.
AA Sequence : APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCE
TQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography.
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
Official Symbol Csf2
Synonyms CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM
Gene ID 12981
mRNA Refseq NM_009969.4
Protein Refseq NP_034099.2
UniProt ID P01587

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf2 Products

Required fields are marked with *

My Review for All Csf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon