Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2) |
Form : |
Lyophilized |
Bio-activity : |
Measure by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2x 10^7 IU/mg. |
AA Sequence : |
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCE TQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Purity : |
>98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Notes : |
Please use within one month after protein reconstitution. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |