Active GMP Recombinant Mouse Csf2 Protein, His-Tagged
Cat.No. : | Csf2-01M |
Product Overview : | GMP Recombinant Mouse Csf2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2) |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2x 10^7 IU/mg. |
AA Sequence : | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCE TQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ] |
Official Symbol | Csf2 |
Synonyms | CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM |
Gene ID | 12981 |
mRNA Refseq | NM_009969.4 |
Protein Refseq | NP_034099.2 |
UniProt ID | P01587 |
◆ Recombinant Proteins | ||
Csf2-507M | Recombinant Mouse Csf2 protein(Met1-Lys141) | +Inquiry |
CSF2-4386F | Recombinant Feline CSF2 Protein | +Inquiry |
GM-CSF-3367M | Recombinant Mouse GM-CSF protein, His-tagged | +Inquiry |
CSF2-294R | Recombinant Rat CSF2 protein(Ala18-Lys144), His-tagged | +Inquiry |
CSF2-038B | Recombinant Bovine CSF2 protein, His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *
0
Inquiry Basket