Active GMP Recombinant Mouse Egf Protein, His-Tagged
Cat.No. : | Egf-01M |
Product Overview : | GMP Recombinant Mouse Egf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <80 pg/mL. The specific activity of recombinant mouse EGF is approximately >1x 10^7 IU/mg. |
AA Sequence : | MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Egf |
Gene ID | 13645 |
mRNA Refseq | NM_001310737.1 |
Protein Refseq | NP_001297666.1 |
UniProt ID | A0A0G2JF92 |
◆ Recombinant Proteins | ||
Egf-873M | Recombinant Mouse Egf Protein, His-tagged | +Inquiry |
Egf-291E | Active Recombinant Rat Egf Protein | +Inquiry |
EGF-2509H | Recombinant Human EGF protein(981-1020 aa), N-MBP & C-His-tagged | +Inquiry |
Egf-038E | Active Recombinant Mouse Egf (977-1029aa), Met tagged | +Inquiry |
EGF-362C | Active Recombinant Canine EGF protein(Asn973-Arg1024), His-tagged | +Inquiry |
◆ Native Proteins | ||
Egf -635R | Native Rat Egf protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *
0
Inquiry Basket