Active GMP Recombinant Porcine TGFB1 Protein, His-Tagged
Cat.No. : | TGFB1-01P |
Product Overview : | GMP Recombinant Porcine TGFB1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. |
AA Sequence : | MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | TGFB1 transforming growth factor beta 1 [ Sus scrofa (pig) ] |
Official Symbol | TGFB1 |
Synonyms | TGF-BETA-1 |
Gene ID | 397078 |
mRNA Refseq | NM_214015.2 |
Protein Refseq | NP_999180.2 |
UniProt ID | P07200 |
◆ Recombinant Proteins | ||
TGFB1-137H | Recombinant Human TGFB1 protein, His & Avi-tagged | +Inquiry |
TGFB1-6429H | Recombinant Human TGFB1 Protein (Gly316-Ser390), N-His tagged | +Inquiry |
TGFB1-4129H | Recombinant Human TGFB1 Protein(Leu30-Ser390 (C33S)), His-Avi-tagged, Biotinylated | +Inquiry |
TGFB1-028C | Recombinant Cynomolgus TGFB1 Protein(Leu 30 - Ser 390 (C33S)), His-tagged | +Inquiry |
TGFB1-7543H | Recombinant Human TGFB1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
0
Inquiry Basket