| Species : |
Porcine |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene. |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. |
| AA Sequence : |
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
