Active GMP Recombinant Porcine TGFB1 Protein, His-Tagged
| Cat.No. : | TGFB1-01P |
| Product Overview : | GMP Recombinant Porcine TGFB1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Porcine |
| Source : | E.coli |
| Tag : | His |
| Description : | Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene. |
| Form : | Lyophilized |
| Bio-activity : | Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. |
| AA Sequence : | MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : | Please use within one month after protein reconstitution. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Gene Name | TGFB1 transforming growth factor beta 1 [ Sus scrofa (pig) ] |
| Official Symbol | TGFB1 |
| Synonyms | TGF-BETA-1 |
| Gene ID | 397078 |
| mRNA Refseq | NM_214015.2 |
| Protein Refseq | NP_999180.2 |
| UniProt ID | P07200 |
| ◆ Recombinant Proteins | ||
| TGFB1-0758M | Recombinant Mouse / Rat TGFB1 protein, Avi-tagged, Biotinylated | +Inquiry |
| TGFB1-345H | Recombinant Human TGFB1 protein, His/MBP-tagged | +Inquiry |
| TGFB1-6035R | Recombinant Rat TGFB1 Protein | +Inquiry |
| TGF-137H | Recombinant Human TGF protein | +Inquiry |
| TGFB-13H | Recombinant Human TGFB1 Protein, Fc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
| TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
| TGFB1-445HKCL | Human TGFB1 Knockdown Cell Lysate | +Inquiry |
| TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
