Recombinant Human TGFB1 Protein, Fc-tagged

Cat.No. : TGFB-13H
Product Overview : Recombinant Human TGFB1 Protein with Fc tag was expressed in HEK293.
Availability August 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.
Form : Liquid
AA Sequence : ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCSLEVLFQGGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
Purity : > 90% determined by SDS-PAGE (Reduced)
Storage : Store at -20 to -80 centigrade.
Storage Buffer : PBS, pH 6.8
Gene Name TGFB1 transforming growth factor beta 1 [ Homo sapiens (human) ]
Official Symbol TGFB1
Synonyms TGFB1; transforming growth factor beta 1; CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; transforming growth factor beta-1 proprotein; TGF-beta-1; latency-associated peptide; prepro-transforming growth factor beta-1; transforming growth factor beta1
Gene ID 7040
mRNA Refseq NM_000660
Protein Refseq NP_000651
MIM 190180
UniProt ID P01137

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFB1 Products

Required fields are marked with *

My Review for All TGFB1 Products

Required fields are marked with *

0
cart-icon