| Species : |
Dog |
| Source : |
E.coli |
| Description : |
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. |
| Form : |
Liquid |
| Bio-activity : |
The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 2 ng/mL. |
| Molecular Mass : |
15 kDa |
| AA Sequence : |
MHKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -88 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) |
