Active Recombinant Full Length Human ACTA2 Protein, C-Flag-tagged
Cat.No. : | ACTA2-676HFL |
Product Overview : | Recombinant Full Length Human ACTA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Pull-down assay |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Vascular smooth muscle contraction |
Full Length : | Full L. |
Gene Name | ACTA2 actin alpha 2, smooth muscle [ Homo sapiens (human) ] |
Official Symbol | ACTA2 |
Synonyms | ACTSA |
Gene ID | 59 |
mRNA Refseq | NM_001141945.3 |
Protein Refseq | NP_001135417.1 |
MIM | 102620 |
UniProt ID | P62736 |
◆ Recombinant Proteins | ||
ACTA2-27340TH | Recombinant Human ACTA2 | +Inquiry |
ACTA2-676HFL | Active Recombinant Full Length Human ACTA2 Protein, C-Flag-tagged | +Inquiry |
ACTA2-6139H | Recombinant Human ACTA2 Protein (Met1-Phe377), N-His tagged | +Inquiry |
ACTA2-189H | Recombinant Human ACTA2 Protein, MYC/DDK-tagged | +Inquiry |
ACTA2-7153H | Recombinant Human ACTA2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTA2-9066HCL | Recombinant Human ACTA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTA2 Products
Required fields are marked with *
My Review for All ACTA2 Products
Required fields are marked with *
0
Inquiry Basket