Recombinant Human ACTA2 protein, GST-tagged

Cat.No. : ACTA2-7155H
Product Overview : Recombinant Human ACTA2 protein(1-50 aa), fused with GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-50 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ACTA2 actin, alpha 2, smooth muscle, aorta [ Homo sapiens ]
Official Symbol ACTA2
Synonyms ACTA2; actin, alpha 2, smooth muscle, aorta; actin, aortic smooth muscle; ACTSA; alpha 2 actin; alpha-actin-2; alpha-cardiac actin; growth-inhibiting gene 46; cell growth-inhibiting gene 46 protein; AAT6; MYMY5;
Gene ID 59
mRNA Refseq NM_001141945
Protein Refseq NP_001135417
MIM 102620
UniProt ID P62736

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTA2 Products

Required fields are marked with *

My Review for All ACTA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon