Recombinant Human ACTA2 protein, GST-tagged
Cat.No. : | ACTA2-7155H |
Product Overview : | Recombinant Human ACTA2 protein(1-50 aa), fused with GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-50 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ACTA2 actin, alpha 2, smooth muscle, aorta [ Homo sapiens ] |
Official Symbol | ACTA2 |
Synonyms | ACTA2; actin, alpha 2, smooth muscle, aorta; actin, aortic smooth muscle; ACTSA; alpha 2 actin; alpha-actin-2; alpha-cardiac actin; growth-inhibiting gene 46; cell growth-inhibiting gene 46 protein; AAT6; MYMY5; |
Gene ID | 59 |
mRNA Refseq | NM_001141945 |
Protein Refseq | NP_001135417 |
MIM | 102620 |
UniProt ID | P62736 |
◆ Recombinant Proteins | ||
ACTA2-27340TH | Recombinant Human ACTA2 | +Inquiry |
ACTA2-2890C | Recombinant Chicken ACTA2 | +Inquiry |
ACTA2-7151H | Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta, His-tagged | +Inquiry |
ACTA2-212H | Recombinant Human ACTA2 Protein, GST-tagged | +Inquiry |
ACTA2-01H | Recombinant Human ACTA2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTA2-9066HCL | Recombinant Human ACTA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTA2 Products
Required fields are marked with *
My Review for All ACTA2 Products
Required fields are marked with *