Recombinant Human DIRAS3 protein, GST-tagged
| Cat.No. : | DIRAS3-2819H |
| Product Overview : | Recombinant Human DIRAS3 protein(O95661)(1-229aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-229aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.5 kDa |
| AA Sequence : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
| Official Symbol | DIRAS3 |
| Synonyms | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI; |
| Gene ID | 9077 |
| mRNA Refseq | NM_004675 |
| Protein Refseq | NP_004666 |
| MIM | 605193 |
| UniProt ID | O95661 |
| ◆ Recombinant Proteins | ||
| DIRAS3-128H | Recombinant Human DIRAS3, Fc tagged | +Inquiry |
| DIRAS3-2819H | Recombinant Human DIRAS3 protein, GST-tagged | +Inquiry |
| DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
| DIRAS3-1269R | Recombinant Rhesus monkey DIRAS3 Protein, His-tagged | +Inquiry |
| DIRAS3-2573HF | Recombinant Full Length Human DIRAS3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *
