Recombinant Human DIRAS3 Protein, GST-tagged
Cat.No. : | DIRAS3-2638H |
Product Overview : | Human DIRAS3 full-length ORF ( AAH05362, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 50.93 kDa |
AA Sequence : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
Official Symbol | DIRAS3 |
Synonyms | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI; |
Gene ID | 9077 |
mRNA Refseq | NM_004675 |
Protein Refseq | NP_004666 |
MIM | 605193 |
UniProt ID | O95661 |
◆ Recombinant Proteins | ||
DIRAS3-0267H | Recombinant Human DIRAS3 protein, mFc-tagged | +Inquiry |
DIRAS3-1094R | Recombinant Rhesus Macaque DIRAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-6778H | Recombinant Human DIRAS3 protein, His-tagged | +Inquiry |
DIRAS3-4624H | Recombinant Human DIRAS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIRAS3-128H | Recombinant Human DIRAS3, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *