Recombinant Human DIRAS3 Protein, GST-tagged

Cat.No. : DIRAS3-2638H
Product Overview : Human DIRAS3 full-length ORF ( AAH05362, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
Molecular Mass : 50.93 kDa
AA Sequence : MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ]
Official Symbol DIRAS3
Synonyms DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI;
Gene ID 9077
mRNA Refseq NM_004675
Protein Refseq NP_004666
MIM 605193
UniProt ID O95661

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIRAS3 Products

Required fields are marked with *

My Review for All DIRAS3 Products

Required fields are marked with *

0
cart-icon