Active Recombinant Full Length Human IL17RD Protein, C-Flag-tagged
Cat.No. : | IL17RD-724HFL |
Product Overview : | Recombinant Full Length Human IL17RD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not require the interleukin. The gene product also affects fibroblast growth factor signaling, inhibiting or stimulating growth through MAPK/ERK signaling. Alternate splicing generates multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 82.2 kDa |
AA Sequence : | MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLYNITFKYDNCTTYLNPV GKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSF KRTGMESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQH GSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTR KVMHYALKPVHSPWAGPIRAVAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESSTYTAALPRE RLRPRPKVFLCYSSKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCREGQREWVIQKIHESQFIIV VCSKGMKYFVDKKNYKHKGGGRGSGKGELFLVAVSAIAEKLRQAKQSSSAALSKFIAVYFDYSCEGDVPG ILDLSTKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWF EKQFVPFHPPPLRYREPVLEKFDSGLVLNDVMCKPGPESDFCLKVEAAVLGATGPADSQHESQHGGLDQD GEARPALDGSAALQPLLHTVKAGSPSDMPRDSGIYDSSVPSSELSLPLMEGLSTDQTETSSLTESVSSSS GLGEEEPPALPSKLLSSGSCKADLGCRSYTDELHAVAPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | IL17RD interleukin 17 receptor D [ Homo sapiens (human) ] |
Official Symbol | IL17RD |
Synonyms | SEF; HH18; IL-17RD; IL17RLM |
Gene ID | 54756 |
mRNA Refseq | NM_017563.5 |
Protein Refseq | NP_060033.3 |
MIM | 606807 |
UniProt ID | Q8NFM7 |
◆ Recombinant Proteins | ||
IL17RD-8128M | Recombinant Mouse IL17RD Protein | +Inquiry |
Il17rd-3502M | Recombinant Mouse Il17rd Protein, Myc/DDK-tagged | +Inquiry |
IL17RD-1054C | Recombinant Canine IL17RD Protein, Fc-tagged | +Inquiry |
Il17rd-7985R | Recombinant Rat Il17rd protein, His & T7-tagged | +Inquiry |
Il17rd-7984M | Recombinant Mouse Il17rd protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17RD-001CCL | Recombinant Canine IL17RD cell lysate | +Inquiry |
IL17RD-2919HCL | Recombinant Human IL17RD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17RD Products
Required fields are marked with *
My Review for All IL17RD Products
Required fields are marked with *
0
Inquiry Basket