Active Recombinant Full Length Human IRF5 Protein, C-Flag-tagged
Cat.No. : | IRF5-555HFL |
Product Overview : | Recombinant Full Length Human IRF5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 56.5 kDa |
AA Sequence : | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA GEEEEEEEELQRMLPSLSLTDAVQSGPHMTPYSLLKEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPP GNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRL FYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKV FWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLI TVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLG VGQGPWPMHPAGMQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | IRF5 interferon regulatory factor 5 [ Homo sapiens (human) ] |
Official Symbol | IRF5 |
Synonyms | SLEB10 |
Gene ID | 3663 |
mRNA Refseq | NM_001098627.4 |
Protein Refseq | NP_001092097.2 |
MIM | 607218 |
UniProt ID | Q13568 |
◆ Recombinant Proteins | ||
IRF5-004H | Recombinant Human IRF5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-2695H | Recombinant Human IRF5 Protein (Glu232-Ala477), N-His tagged | +Inquiry |
Irf5-010M | Recombinant Mouse Irf5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-003H | Recombinant Human IRF5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-936H | Recombinant Human IRF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *
0
Inquiry Basket