Active Recombinant Full Length Human MARCKS Protein, C-Flag-tagged
Cat.No. : | MARCKS-395HFL |
Product Overview : | Recombinant Full Length Human MARCKS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Binding assay |
Molecular Mass : | 31.4 kDa |
AA Sequence : | MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKE EPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAED GATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAA SGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACE APSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Fc gamma R-mediated phagocytosis |
Full Length : | Full L. |
Gene Name | MARCKS myristoylated alanine rich protein kinase C substrate [ Homo sapiens (human) ] |
Official Symbol | MARCKS |
Synonyms | MACS; 80K-L; PKCSL; PRKCSL |
Gene ID | 4082 |
mRNA Refseq | NM_002356.7 |
Protein Refseq | NP_002347.5 |
MIM | 177061 |
UniProt ID | P29966 |
◆ Recombinant Proteins | ||
MARCKS-17H | Recombinant Human MARCKS protein, GST-tagged | +Inquiry |
MARCKS-1097H | Recombinant Human MARCKS Protein, His&SUMO-tagged | +Inquiry |
MARCKS-395HFL | Active Recombinant Full Length Human MARCKS Protein, C-Flag-tagged | +Inquiry |
MARCKS-5370M | Recombinant Mouse MARCKS Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCKS-7029C | Recombinant Chicken MARCKS | +Inquiry |
◆ Native Proteins | ||
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MARCKS Products
Required fields are marked with *
My Review for All MARCKS Products
Required fields are marked with *
0
Inquiry Basket