Active Recombinant Full Length Human ODC1 Protein, C-Flag-tagged
Cat.No. : | ODC1-59HFL |
Product Overview : | Recombinant Full Length Human ODC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 51 kDa |
AA Sequence : | MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ODC1 ornithine decarboxylase 1 [ Homo sapiens (human) ] |
Official Symbol | ODC1 |
Synonyms | ODC; BABS; NEDBA; NEDBIA |
Gene ID | 4953 |
mRNA Refseq | NM_002539.3 |
Protein Refseq | NP_002530.1 |
MIM | 165640 |
UniProt ID | P11926 |
◆ Recombinant Proteins | ||
ODC1-4156R | Recombinant Rat ODC1 Protein | +Inquiry |
ODC1-323H | Recombinant Human ODC1 Protein, His-tagged | +Inquiry |
Odc1-1883R | Recombinant Rat Odc1 Protein, His-tagged | +Inquiry |
Odc1-4572M | Recombinant Mouse Odc1 Protein, Myc/DDK-tagged | +Inquiry |
ODC1-4761H | Recombinant Human ODC1 Protein (Asp15-Leu259), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ODC1 Products
Required fields are marked with *
My Review for All ODC1 Products
Required fields are marked with *
0
Inquiry Basket