Active Recombinant Full Length Human PNP Protein, C-Flag-tagged
Cat.No. : | PNP-715HFL |
Product Overview : | Recombinant Full Length Human PNP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB standard |
Molecular Mass : | 31.9 kDa |
AA Sequence : | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA SIPLPDKASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | PNP purine nucleoside phosphorylase [ Homo sapiens (human) ] |
Official Symbol | PNP |
Synonyms | NP; PUNP; PRO1837 |
Gene ID | 4860 |
mRNA Refseq | NM_000270.4 |
Protein Refseq | NP_000261.2 |
MIM | 164050 |
UniProt ID | P00491 |
◆ Recombinant Proteins | ||
PNP-832H | Recombinant Human PNP Protein, GST-tagged | +Inquiry |
PNP-2498H | Recombinant Human PNP protein(11-280 aa), C-His-tagged | +Inquiry |
Pnp-7995R | Recombinant Rat Pnp protein, His & T7-tagged | +Inquiry |
Pnp-7994M | Recombinant Mouse Pnp protein, His & T7-tagged | +Inquiry |
PNP-715HFL | Active Recombinant Full Length Human PNP Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNP Products
Required fields are marked with *
My Review for All PNP Products
Required fields are marked with *
0
Inquiry Basket