Active Recombinant Human ACVR2A, Fc-tagged, Biotinylated

Cat.No. : ACVR2A-532H
Product Overview : The recombinant human ACVR2A-Fc fusion protein is expressed as a 344 amino acid protein consisting of Ala20 - Pro135 region of ACVR2A (UniProt accession #P27037) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 20-135 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized ACVR2A binds Activin or Inhibin in a functional ELISA. Neutralize Activin-induced inhibition of MPC11 cell proliferation and hemoglobin expression in K562 human chronic myelogenous leukemia cells.
Molecular Mass : Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): ~55
AA Sequence : AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVE KKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition.
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name ACVR2A activin A receptor, type IIA [ Homo sapiens ]
Official Symbol ACVR2A
Synonyms ACVR2A; activin A receptor, type IIA; activin A receptor, type II , ACVR2; activin receptor type-2A; ACTRII; ACVR2;
Gene ID 92
mRNA Refseq NM_001616
Protein Refseq NP_001607
MIM 102581
UniProt ID P27037
Chromosome Location 2q22.2-q23.3
Pathway ALK1 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem;
Function ATP binding; contributes_to activin binding; activin receptor activity, type II; contributes_to activin-activated receptor activity; coreceptor activity; growth factor binding; inhibin beta-A binding; inhibin beta-B binding; metal ion binding; nucleotide binding; protein binding; contributes_to protein binding; protein self-association; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR2A Products

Required fields are marked with *

My Review for All ACVR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon