Active Recombinant Human ADAM17
Cat.No. : | ADAM17-593H |
Product Overview : | Recombinant Human ADAM17 was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Non |
Protein Length : | 215 to 651 |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway. |
Form : | Lyophilised |
Bio-activity : | Activity was tested using the synthetic peptide, Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Dpa(Dnp)-NH2, as a substrate. Specific activity = 280 units/mg. |
Molecular Mass : | 62 kDa |
AA Sequence : | RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKS PQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAY VGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDP DGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSR VDEGEECDPGIMYLNNDTCCNS DCTLKEGVQC SDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDD TVCLDLGKCK DGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFL RKGKPCTVGF CDMNGKCEKRVQDVIER |
Purity : | >90% by SDS-PAGE. |
Applications : | Functional Studies; SDS-PAGE |
Storage : | Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. |
Reconstitution : | Reconstitute with sterile deionized water at 0.1µg protein/µl. For long term storage, it is recommended to add a carrier protein (0.1% BSA). Avoid multiple freeze/thaw cycles. |
Gene Name | ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens (human) ] |
Official Symbol | ADAM17 |
Synonyms | ADAM17; CSVP; TACE; NISBD; ADAM18; CD156B; ADAM metallopeptidase domain 17; disintegrin and metalloproteinase domain-containing protein 17; TNF-alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme; NP_003174.3; EC 3.4.24.86 |
Gene ID | 6868 |
mRNA Refseq | NM_003183 |
Protein Refseq | NP_003174 |
MIM | 603639 |
UniProt ID | P78536 |
Chromosome Location | 2p25 |
Pathway | Activated NOTCH1 Transmits Signal to the Nucleus; BDNF signaling pathway; Constitutive Signaling by NOTCH1 PEST Domain Mutants |
Function | Notch binding; PDZ domain binding; interleukin-6 receptor binding |
◆ Recombinant Proteins | ||
ADAM17-1867C | Recombinant Chicken ADAM17 | +Inquiry |
Adam17-308M | Recombinant Mouse Adam17 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM17-2732H | Recombinant Human ADAM17 protein, His-tagged | +Inquiry |
ADAM17-278H | Recombinant Human ADAM17 Protein, GST-tagged | +Inquiry |
ADAM17-7114H | Recombinant Human ADAM17 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM17-1198RCL | Recombinant Rat ADAM17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM17 Products
Required fields are marked with *
My Review for All ADAM17 Products
Required fields are marked with *
0
Inquiry Basket