Active Recombinant Human ADIPOQ Protein
| Cat.No. : | ADIPOQ-196A |
| Product Overview : | Recombinant Human ADIPOQ Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Description : | Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 2 μg/mL, measured in a cell proliferation assay using M1 cells. |
| Molecular Mass : | 16~17 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ] |
| Official Symbol | ADIPOQ |
| Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1; |
| Gene ID | 9370 |
| mRNA Refseq | NM_001177800 |
| Protein Refseq | NP_001171271 |
| MIM | 605441 |
| UniProt ID | Q15848 |
| ◆ Recombinant Proteins | ||
| Adipoq-3986M | Recombinant Mouse Adipoq Protein (Met1-Asn247), C-His tagged | +Inquiry |
| Adipoq-032M | Recombinant Mouse Adipoq Protein, His-tagged | +Inquiry |
| ADIPOQ-2647C | Recombinant Chicken ADIPOQ protein, His & T7-tagged | +Inquiry |
| ADIPOQ-4473B | Recombinant Bovine ADIPOQ protein, His-SUMO-tagged | +Inquiry |
| ADIPOQ-1849H | Recombinant Human Adiponectin, C1Q And Collagen Domain Containing | +Inquiry |
| ◆ Native Proteins | ||
| ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
| ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *
