Active Recombinant Human ADIPOQ Protein

Cat.No. : ADIPOQ-196A
Product Overview : Recombinant Human ADIPOQ Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2 μg/mL, measured in a cell proliferation assay using M1 cells.
Molecular Mass : 16~17 kDa, observed by reducing SDS-PAGE.
AA Sequence : KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ]
Official Symbol ADIPOQ
Synonyms ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1;
Gene ID 9370
mRNA Refseq NM_001177800
Protein Refseq NP_001171271
MIM 605441
UniProt ID Q15848

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADIPOQ Products

Required fields are marked with *

My Review for All ADIPOQ Products

Required fields are marked with *

0
cart-icon
0
compare icon