Active Recombinant Human AHSG Protein

Cat.No. : AHSG-469H
Product Overview : Human AHSG (P02765) partial recombinant protein expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008]
Form : Lyophilized
Bio-activity : Determined by its ability to inhibit Cathespin V cleavage of a fluorogenic peptide substrate Z-LR-AMC (RLUs). The expected IC50 is ≤ 100nM.
Molecular Mass : 45-55 kDa
AA Sequence : A-Chain:APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLB-Chain:TVVQPSVGAAAGPVVPPCPGRIRHFKV
Endotoxin : Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
Purity : 98%
Applications : Functional Study
SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20centigrade.Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name AHSG alpha-2-HS-glycoprotein [ Homo sapiens ]
Official Symbol AHSG
Synonyms AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS;
Gene ID 197
mRNA Refseq NM_001622
Protein Refseq NP_001613
MIM 138680
UniProt ID P02765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHSG Products

Required fields are marked with *

My Review for All AHSG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon