Active Recombinant Human AMHR2, Fc-tagged

Cat.No. : AMHR2-536H
Product Overview : The recombinant human AMHR2-Fc fusion protein is expressed as a 354 amino acid protein consisting of Pro18 - Ser144 region of AMHR2 (UniProt accession #Q16671) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 18-144 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Recombinant AMHR2 protein binds human AMH/MIS and blocks AMH/MIS-induced signaling activity
Molecular Mass : Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLH CDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGESTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name AMHR2 anti-Mullerian hormone receptor, type II [ Homo sapiens ]
Official Symbol AMHR2
Synonyms AMHR2; anti-Mullerian hormone receptor, type II; anti-Muellerian hormone type-2 receptor; MISR2; MISRII; M?llerian inhibiting substance type II receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; Mullerian inhibiting substance type II receptor; AMHR; MRII;
Gene ID 269
mRNA Refseq NM_001164690
Protein Refseq NP_001158162
MIM 600956
UniProt ID Q16671
Chromosome Location 12q13
Pathway ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function ATP binding; hormone binding; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta receptor activity, type II;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AMHR2 Products

Required fields are marked with *

My Review for All AMHR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon