Active Recombinant Human BMPR2, Fc-tagged, Biotinylated
Cat.No. : | BMPR2-556H |
Product Overview : | The recombinant human BMPR2-Fc fusion protein is expressed as a 352 amino acid protein consisting of Ser27 - Thr150 region of BMPR2 (UniProt accession #Q13873) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 27-150 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Recombinant BMPR2 protein binds human/mouse BMP2/BMP7/GDF9, and blocks BMP2/BMP7/GDF9-induced signaling activity |
Molecular Mass : | Calculated molecular mass (kDa): 39.5; Estimated by SDS-PAGE under reducing condition (kDa): ~55 |
AA Sequence : | SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECV VTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETSTGTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ] |
Official Symbol | BMPR2 |
Synonyms | BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945; |
Gene ID | 659 |
mRNA Refseq | NM_001204 |
Protein Refseq | NP_001195 |
MIM | 600799 |
UniProt ID | Q13873 |
Chromosome Location | 2q33-q34 |
Pathway | ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; BMP signalling and regulation, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Heart Development, organism-specific biosystem; |
Function | ATP binding; activin receptor activity, type II; growth factor binding; metal ion binding; nucleotide binding; protein binding; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
BMPR2-577H | Recombinant Human BMPR2 protein, His & T7-tagged | +Inquiry |
BMPR2-1375H | Recombinant Human BMPR2 Protein (Ser27-Ile151), C-His tagged | +Inquiry |
BMPR2-134H | Recombinant Human BMPR2, His-tagged | +Inquiry |
BMPR2-377R | Recombinant Rhesus Macaque BMPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMPR2-2707H | Recombinant Human BMPR2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR2-2717HCL | Recombinant Human BMPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR2 Products
Required fields are marked with *
My Review for All BMPR2 Products
Required fields are marked with *