Active Recombinant Human BMPR2, Fc-tagged, Biotinylated

Cat.No. : BMPR2-556H
Product Overview : The recombinant human BMPR2-Fc fusion protein is expressed as a 352 amino acid protein consisting of Ser27 - Thr150 region of BMPR2 (UniProt accession #Q13873) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 27-150 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Recombinant BMPR2 protein binds human/mouse BMP2/BMP7/GDF9, and blocks BMP2/BMP7/GDF9-induced signaling activity
Molecular Mass : Calculated molecular mass (kDa): 39.5; Estimated by SDS-PAGE under reducing condition (kDa): ~55
AA Sequence : SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECV VTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETSTGTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ]
Official Symbol BMPR2
Synonyms BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945;
Gene ID 659
mRNA Refseq NM_001204
Protein Refseq NP_001195
MIM 600799
UniProt ID Q13873
Chromosome Location 2q33-q34
Pathway ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; BMP signalling and regulation, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Heart Development, organism-specific biosystem;
Function ATP binding; activin receptor activity, type II; growth factor binding; metal ion binding; nucleotide binding; protein binding; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMPR2 Products

Required fields are marked with *

My Review for All BMPR2 Products

Required fields are marked with *

0
cart-icon