Active Recombinant Human BTLA, Fc-tagged, Biotinylated
Cat.No. : | BTLA-565H |
Product Overview : | The recombinant human CD272-Fc fusion protein is expressed as a 350 amino acid protein consisting of Lys31 - Pro152 region of CD272 (UniProt accession #Q7Z6A9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 31-152 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds human HVEM/TNFRSF14 and blocks HVEM-CD272 mediated signaling activity. |
Molecular Mass : | Calculated molecular mass 39.6 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation. |
AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEP VLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
Official Symbol | BTLA |
Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
Gene ID | 151888 |
mRNA Refseq | NM_001085357 |
Protein Refseq | NP_001078826 |
MIM | 607925 |
UniProt ID | Q7Z6A9 |
Chromosome Location | 3q13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
Btla-5733M | Recombinant Mouse Btla protein, His-tagged | +Inquiry |
BTLA-193H | Recombinant Human BTLA(Lys31-Leu150) Protein, C-mFc-tagged | +Inquiry |
Btla-1844R | Recombinant Rat Btla protein, His & T7-tagged | +Inquiry |
BTLA-1148RF | Active Recombinant Rat Btla Protein, Fc-tagged, FITC conjugated | +Inquiry |
BTLA-8698M | Recombinant Mouse BTLA protein(Met1-Gly176), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *