Active Recombinant Human BTLA, Fc-tagged, Biotinylated

Cat.No. : BTLA-565H
Product Overview : The recombinant human CD272-Fc fusion protein is expressed as a 350 amino acid protein consisting of Lys31 - Pro152 region of CD272 (UniProt accession #Q7Z6A9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 31-152 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human HVEM/TNFRSF14 and blocks HVEM-CD272 mediated signaling activity.
Molecular Mass : Calculated molecular mass 39.6 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation.
AA Sequence : KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEP VLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name BTLA B and T lymphocyte associated [ Homo sapiens ]
Official Symbol BTLA
Synonyms BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743;
Gene ID 151888
mRNA Refseq NM_001085357
Protein Refseq NP_001078826
MIM 607925
UniProt ID Q7Z6A9
Chromosome Location 3q13.2
Pathway Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTLA Products

Required fields are marked with *

My Review for All BTLA Products

Required fields are marked with *

0
cart-icon