Active Recombinant Human CCL16 Protein (97 aa)

Cat.No. : CCL16-268C
Product Overview : Recombinant human HCC-4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC-4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Protein Length : 97
Description : Human HCC­4, also named NCC­4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of human HCC-4/CCL16 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/mL.
Molecular Mass : 12 kDa, observed by reducing SDS-PAGE.
AA Sequence : QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human HCC-4/CCL16 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human HCC-4/CCL16 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
Official Symbol CCL16
Synonyms CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051;
Gene ID 6360
mRNA Refseq NM_004590
Protein Refseq NP_004581
MIM 601394
UniProt ID O15467

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL16 Products

Required fields are marked with *

My Review for All CCL16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon