Active Recombinant Human CCL16 Protein (97 aa)
Cat.No. : | CCL16-268C |
Product Overview : | Recombinant human HCC-4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC-4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 97 |
Description : | Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human HCC-4/CCL16 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/mL. |
Molecular Mass : | 12 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human HCC-4/CCL16 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human HCC-4/CCL16 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ] |
Official Symbol | CCL16 |
Synonyms | CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051; |
Gene ID | 6360 |
mRNA Refseq | NM_004590 |
Protein Refseq | NP_004581 |
MIM | 601394 |
UniProt ID | O15467 |
◆ Recombinant Proteins | ||
CCL16-07H | Recombinant Human CCL16 protein | +Inquiry |
CCL16-242H | Recombinant Human CCL16 protein, His-tagged | +Inquiry |
CCL16-296H | Recombinant Human CCL16, StrepII-tagged | +Inquiry |
CCL16-268C | Active Recombinant Human CCL16 Protein (97 aa) | +Inquiry |
CCL16-0614H | Recombinant Human CCL16 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL16 Products
Required fields are marked with *
My Review for All CCL16 Products
Required fields are marked with *
0
Inquiry Basket