Recombinant Human CCL16 protein, His-SUMO-tagged

Cat.No. : CCL16-2648H
Product Overview : Recombinant Human CCL16 protein(O15467)(24-120aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 24-120aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27.2 kDa
AA Sequence : QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
Official Symbol CCL16
Synonyms CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051;
Gene ID 6360
mRNA Refseq NM_004590
Protein Refseq NP_004581
MIM 601394
UniProt ID O15467

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL16 Products

Required fields are marked with *

My Review for All CCL16 Products

Required fields are marked with *

0
cart-icon