Recombinant Human CCL16 protein, His-SUMO-tagged
Cat.No. : | CCL16-2648H |
Product Overview : | Recombinant Human CCL16 protein(O15467)(24-120aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-120aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.2 kDa |
AA Sequence : | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ] |
Official Symbol | CCL16 |
Synonyms | CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051; |
Gene ID | 6360 |
mRNA Refseq | NM_004590 |
Protein Refseq | NP_004581 |
MIM | 601394 |
UniProt ID | O15467 |
◆ Recombinant Proteins | ||
CCL16-354H | Active Recombinant Human CCL16,HIgG1 Fc-tagged | +Inquiry |
CCL16-242H | Recombinant Human CCL16 protein, His-tagged | +Inquiry |
CCL16-07H | Recombinant Human CCL16 protein | +Inquiry |
CCL16-352H | Active Recombinant Human CCL16, HIgG1 Fc-tagged, mutant | +Inquiry |
CCL16-2648H | Recombinant Human CCL16 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL16 Products
Required fields are marked with *
My Review for All CCL16 Products
Required fields are marked with *
0
Inquiry Basket