Active Recombinant Human CD99, Fc-tagged, Biotinylated
Cat.No. : | CD99-589H |
Product Overview : | The recombinant human CD99-Fc is expressed as a 329 amino acid protein consisting of Asp23 - Ala123 region of CD99 (UniProt #P14209 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-123 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized CD99-Fc protein supports homophillic interaction with CD99 itself (e.g., via biotinylated CD99 protein) by a functional ELISA. |
Molecular Mass : | Calculated molecular mass (kDa): 35.7; Estimated by SDS-PAGE under reducing condition (kDa): 50-55 |
AA Sequence : | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLA DGVSGGEGKGGSDGGGSHRKEGEEADASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD99 CD99 molecule [ Homo sapiens ] |
Official Symbol | CD99 |
Synonyms | CD99; CD99 molecule; antigen identified by monoclonal antibodies 12E7, F21 and O13 , CD99 antigen , MIC2; CD99 antigen; E2 antigen; surface antigen MIC2; T-cell surface glycoprotein E2; MIC2 (monoclonal 12E7); antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; MIC2; HBA71; MIC2X; MIC2Y; MSK5X; |
Gene ID | 4267 |
mRNA Refseq | NM_001122898 |
Protein Refseq | NP_001116370 |
MIM | 313470 |
UniProt ID | P14209 |
Chromosome Location | Xp22.32 and Yp11.3 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; |
◆ Recombinant Proteins | ||
CD99-176H | Recombinant Human CD99 Protein, His-tagged | +Inquiry |
CD99-087H | Recombinant Human CD99 protein, His-tagged(VLPs) | +Inquiry |
CD99-3393H | Recombinant Human CD99 protein, His-SUMO-tagged | +Inquiry |
CD99-26953TH | Recombinant Human CD99 Protein, GST-tagged | +Inquiry |
CD99-4548H | Recombinant Human CD99 Protein (Met1-Asp122), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99-1360RCL | Recombinant Rat CD99 cell lysate | +Inquiry |
CD99-2203MCL | Recombinant Mouse CD99 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD99 Products
Required fields are marked with *
My Review for All CD99 Products
Required fields are marked with *