Active Recombinant Human CNTF Protein

Cat.No. : CNTF-192C
Product Overview : Recombinant Human CNTF Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: dorsal root ganglion sensory neurons, sympathetic ganglion neurons, embryonic motor neurons, major pelvic ganglion neurons and hippocampal neurons. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The gene for human CNTF has been localized to the proximal region of the long arm of chromosome 11. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL-6, IL-11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.20 μg/mL, measured in a cell proliferation assay using TF-1 cells.
Molecular Mass : 22~28 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Ciliary Neurotrophic Factor (CNTF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Ciliary Neurotrophic Factor (CNTF) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CNTF ciliary neurotrophic factor [ Homo sapiens ]
Official Symbol CNTF
Synonyms CNTF; ciliary neurotrophic factor; HCNTF;
Gene ID 1270
mRNA Refseq NM_000614
Protein Refseq NP_000605
MIM 118945
UniProt ID P26441

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTF Products

Required fields are marked with *

My Review for All CNTF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon