Active Recombinant Mouse Cntf Protein (197 aa)

Cat.No. : Cntf-434C
Product Overview : Recombinant Mouse CNTF produced in E. coli is a single, non-glycosylated polypeptide chain of 197 amino acids and a molecular mass of 22.6 kDa. It has been purified by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 197
Description : Ciliary Neurotrophic Factor (CNTF) is a polypeptide hormone which acts within the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. CNTF is a potent survival factor for neurons and oligodendrocytes and may play a role in reducing tissue damage during increased inflammation. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, however this phenotype is not causally related to neurologic disease.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 30 ng/mL, measured by its ability to induce alkaline phosphatase production byTF-1 Cells.
Molecular Mass : 22.6 kDa, observed by reducing SDS-PAGE.
AA Sequence : AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Mouse CNTF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse CNTF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Cntf ciliary neurotrophic factor [ Mus musculus ]
Official Symbol Cntf
Synonyms CNTF; ciliary neurotrophic factor; AI429687; MGC41235;
Gene ID 12803
mRNA Refseq NM_170786
Protein Refseq NP_740756
UniProt ID P51642

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cntf Products

Required fields are marked with *

My Review for All Cntf Products

Required fields are marked with *

0
cart-icon
0
compare icon