Active Recombinant Human CSH1 Protein, His-tagged

Cat.No. : CSH1-037H
Product Overview : Recombinant human CSH1, fused to His-tag at Cterminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Description : The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using Nb2-11 Rat lymphoma cells. The ED50 range ≤ 0.8 ng/mL.
Molecular Mass : 23.1 kDa
AA Sequence : VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -116 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 30% glycerol
Gene Name CSH1 chorionic somatomammotropin hormone 1 [ Homo sapiens (human) ]
Official Symbol CSH1
Synonyms CSH1; chorionic somatomammotropin hormone 1; PL; CSA; CS-1; CSMT; GHB3; hCS-1; hCS-A; chorionic somatomammotropin hormone 1; Chorionic somatomammotropin hormone 2; choriomammotropin; chorionic somatomammotropin A; chorionic somatomammotropin-1; growth hormone B3; placental lactogen
Gene ID 1442
mRNA Refseq NM_001317
Protein Refseq NP_001308
MIM 150200
UniProt ID P0DML2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSH1 Products

Required fields are marked with *

My Review for All CSH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon