Recombinant Full Length Saccharomyces Cerevisiae Mannosyl Phosphorylinositol Ceramide Synthase Csh1(Csh1) Protein, His-Tagged
Cat.No. : | RFL28207SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mannosyl phosphorylinositol ceramide synthase CSH1(CSH1) Protein (P38287) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQ LIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRS YEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSV PRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQP ADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLC SGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDS VFLDIEKNHAKFTDLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSH1 |
Synonyms | CSH1; YBR161W; YBR1212; Mannosyl phosphorylinositol ceramide synthase CSH1; CSG1/SUR1 homolog 1 |
UniProt ID | P38287 |
◆ Recombinant Proteins | ||
CSH1-007H | Active Recombinant Human CSH1 Protein, His-tagged | +Inquiry |
CSH1-1831H | Recombinant Human CSH1 Protein (Gln28-Arg193), N-His tagged | +Inquiry |
CSH1-037H | Active Recombinant Human CSH1 Protein, His-tagged | +Inquiry |
CSH1-1976H | Recombinant Human CSH1 Protein, GST-tagged | +Inquiry |
CSH1-2183H | Recombinant Human CSH1 protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSH1-2206HCL | Recombinant Human CSH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSH1 Products
Required fields are marked with *
My Review for All CSH1 Products
Required fields are marked with *