Active Recombinant Human CXCL3 Protein (73 aa)

Cat.No. : CXCL3-270C
Product Overview : Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Protein Length : 73
Description : Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b). CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of human GRO-gamma/CXCL3 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/mL.
Molecular Mass : 9 kDa, observed by reducing SDS-PAGE.
AA Sequence : ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ]
Official Symbol CXCL3
Synonyms CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b;
Gene ID 2921
mRNA Refseq NM_002090
Protein Refseq NP_002081
MIM 139111
UniProt ID P19876

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL3 Products

Required fields are marked with *

My Review for All CXCL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon