Active Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 555 conjugated
Cat.No. : | EGFR-28395THAF555 |
Product Overview : | Recombinant Alexa Fluor 555 conjugated fragment, corresponding to extracellular domain amino acids 25-525 of Human EGFR fused to the Fc region of Human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells. |
Availability | April 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 25-525 a.a. |
Description : | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene. |
Form : | Lyophilized |
Bio-activity : | The ED50 is typically 60-100 ng/mL as measured by its ability to neutralize EGF mediated proliferation of murine NIH3T3 fibroblasts. |
N-terminal Sequence Analysis : | Theoretical sequence:LEEKKVCQGTSNKLTQLGTFEDHFLSLQR MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLI ALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENC QKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRE SDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEG KYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVK EITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFS LAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTI NWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | > 95 % as determined by SDS-PAGE |
Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 555 via amines With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters. |
Storage : | Store at +4 centigrade. |
Storage Buffer : | 10% Trehalose, 1% Human serum albumin |
Reconstitution : | It is recommended that 0.5 mL of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4 centigrade is recommended, with longer-term storage in aliquots at -18 to -20 centigrade. Repeated freeze thawing is not recommended. |
Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
Official Symbol | EGFR |
Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); |
Gene ID | 1956 |
mRNA Refseq | NM_005228 |
Protein Refseq | NP_005219 |
MIM | 131550 |
UniProt ID | P00533 |
◆ Recombinant Proteins | ||
EGFR-077H | Recombinant Human EGFR Protein, DYKDDDDK-tagged | +Inquiry |
EGFR-051H | Active Recombinant Human EGFR protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
EGFR-4809HFL | Recombinant Full Length Human EGFR protein, Flag-tagged | +Inquiry |
EGFR-075H | Recombinant Human EGFR T790M Mutant Protein, DYKDDDDK-tagged | +Inquiry |
EGFR-30HAF488 | Recombinant Human EGFR Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
0
Inquiry Basket