Active Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 647 conjugated
| Cat.No. : | EGFR-28395THAF647 |
| Product Overview : | Recombinant Human EGFR Protein extracellular domain fragment (25-525aa), was expressed in modified human 293 cells with C-terminal human IgG1 Fc tag (90-330aa) and Alexa Fluor 647 conjugate (chimeric protein). |
| Availability | January 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 25-525 aa |
| Description : | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene. |
| Form : | Lyophilized |
| Bio-activity : | The ED50 is typically 60-100 ng/mL as measured by its ability to neutralize EGF mediated proliferation of murine NIH3T3 fibroblasts. |
| N-terminal Sequence Analysis : | Theoretical sequence:LEEKKVCQGTSNKLTQLGTFEDHFLSLQR MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLI ALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENC QKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRE SDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEG KYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVK EITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFS LAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTI NWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Purity : | > 95 % as determined by SDS-PAGE |
| Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 647 via amines Excitation = 650 nm Emission = 668 nm |
| Storage : | Store at +4 centigrade. |
| Storage Buffer : | 10% Trehalose, 1% Human serum albumin |
| Reconstitution : | It is recommended that 0.5 mL of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4 centigrade is recommended, with longer-term storage in aliquots at -18 to -20 centigrade. Repeated freeze thawing is not recommended. |
| Conjugation : | Alexa Fluor 647 |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); |
| Gene ID | 1956 |
| mRNA Refseq | NM_005228 |
| Protein Refseq | NP_005219 |
| MIM | 131550 |
| UniProt ID | P00533 |
| ◆ Recombinant Proteins | ||
| EGFR-1228RAF555 | Recombinant Monkey EGFR Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| EGFR-625H | Recombinant Human EGFR protein, MYC/DDK-tagged | +Inquiry |
| EGFR-24H | Recombinant Active Human EGFR (D746-750 G724S) Mutant Protein, GST-tagged | +Inquiry |
| EGFR-629HP | Recombinant Human EGFR protein, Fc-tagged, R-PE labeled | +Inquiry |
| EGFR-1226R | Recombinant Rhesus macaque EGFR protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
| EGFR-151HKCL | Human EGFR Knockdown Cell Lysate | +Inquiry |
| EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
