Active Recombinant Human FGF10 Protein (187 aa), N-His-tagged
Cat.No. : | FGF10-422F |
Product Overview : | Recombinant human Fibroblast Growth Factor-10 (rhFGF-10) with N-terminal His-tag produced in E. coli is a single non-glycosylated polypeptide chain containing 187 amino acids. A fully biologically active molecule, rhFGF-10 has a molecular mass of 21.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 187 |
Description : | Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares the homolog and receptor FGFR2-IIIb with KGF. However, unlike KGF which induces the proliferation and differentiation of various epithelial cells, FGF-10 is an essential factor for the budding and branching morphogenesis during the multi-organ development via the instructive mesenchymal-epithelial interactions. FGF-10 is crucial for lung and limb development, and is regulated by Shh during early development. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 20 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^4 units/mg. |
Molecular Mass : | 21.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MNHKVHHHHHHMDDDDKMLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Fibroblast Growth Factor-10 (rhFGF-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens ] |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
Gene ID | 2255 |
mRNA Refseq | NM_004465 |
Protein Refseq | NP_004456 |
MIM | 602115 |
UniProt ID | O15520 |
◆ Recombinant Proteins | ||
FGF10-4097H | Active Recombinant Human FGF10 Protein | +Inquiry |
FGF10-1981R | Recombinant Rat FGF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF10-232H | Recombinant Human FGF10 protein | +Inquiry |
FGF10-421F | Active Recombinant Human FGF10 Protein (169 aa) | +Inquiry |
FGF10-5387C | Recombinant Cynomolgus monkey FGF10 Protein (His29-Ser209), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket