Active Recombinant Human FGF2 Protein (146 aa)
| Cat.No. : | FGF2-401F |
| Product Overview : | Recombinant human Fibroblast Growth Factor-basic (146 a.a.) (rhFGF-basic) produced in E. coli is a single non-glycosylated polypeptide chain containing 146 amino acids. A fully biologically active molecule, rhFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 146 |
| Description : | Fibroblast Growth Factor-basic (FGF-basic), also known as FGF-2, is a pleiotropic cytokine and one of the prototypic members of the heparin-binding FGF family. Like other FGF family members, FGF-basic has the β trefoil structure. In vivo, FGF-basic is produced by a variety of cells, including cardiomycotes, fibroblasts, and vascular cells. FGF-basic regulates a variety of processes including cell proliferation, differentiation, survival, adhesion, motility, apoptosis, limb formation and wound healing. FGF-basic can be tumorigenic due to its role in angiogenesis and blood vessel remodeling. The angiogenic effects of FGF-basic can produce beneficial cardioprotection during acute heart injury. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 0.25 ng/mL, measured by the cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 4 × 10^6 units/mg. |
| Molecular Mass : | 16.4 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analysis. |
| Storage : | Lyophilized recombinant human Fibroblast Growth Factor-basic (146 a.a.) (rhFGF-basic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-basic remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O at 50 μg/mL. |
| Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ] |
| Official Symbol | FGF2 |
| Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
| Gene ID | 2247 |
| mRNA Refseq | NM_002006 |
| Protein Refseq | NP_001997 |
| MIM | 134920 |
| UniProt ID | P09038 |
| ◆ Recombinant Proteins | ||
| FGF2-022E | Active Recombinant Human FGF2 (143-288aa), Ala tagged | +Inquiry |
| FGF2-9685H | Recombinant Human FGF2 protein, His-tagged | +Inquiry |
| FGF2-4422B | Recombinant Bovine FGF2 protein, His-tagged | +Inquiry |
| FGF2-3232M | Recombinant Mouse FGF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGF2-018E | Recombinant Bovine FGF2 protein | +Inquiry |
| ◆ Native Proteins | ||
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
| FGF2-34B | Active Native Bovine bFGF | +Inquiry |
| FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
