Recombinant Human FLT3LG
Cat.No. : | FLT3LG-28905TH |
Product Overview : | Recombinant full length extracellular domain of Human Flt3 Ligand protein expressed in modified Human 293 cells, amino acids 27-184. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 27-184 a.a. |
Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al. |
Biological activity : | Activity:The ED50 of FLT3LG-28905TH is typically between 0.5 -5.0 ng/ml as measured in a cell proliferation assay using the OCI/AML5 Human leukemia cell line. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:TQDCSFQHSPISSDFAVKIRELSDYLLQD YPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSK MQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQE TSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSP RPLEATAPTAPAS |
Full Length : | Full L. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
Uniprot ID | P49771 |
Chromosome Location | 19q13.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | cytokine activity; receptor binding; |
◆ Recombinant Proteins | ||
FLT3LG-152H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-764H | Recombinant Human FLT3LG protein, hFc-tagged | +Inquiry |
FLT3LG-11H | Active Recombinant Human FLT3LG Protein, His tagged | +Inquiry |
FLT3LG-312H | Recombinant Human FLT3LG protein, His-tagged | +Inquiry |
RFL7140HF | Recombinant Full Length Human Fms-Related Tyrosine Kinase 3 Ligand(Flt3Lg) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket