Active Recombinant Human GDNF Protein
Cat.No. : | GDNF-109H |
Product Overview : | Recombinant Human GDNF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Glial cell-derived neurotrophic factor (GDNF) is a neurotrophic factor that signals through a multicomponent receptor system to activate receptor tyrosine kinase RET signaling. GDNF promotes dopamine uptake, prevents motor neuron apoptosis, and supports the survival and differentiation of neurons. |
Bio-activity : | C6 proliferation, ≤3 μg/mL; ≥3.3 x 10^2 units/mg |
Molecular Mass : | Dimer, 15.2/30.4 kDa (135/270 aa) |
AA Sequence : | MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium citrate, 100 mM sodium chloride, pH 4.0 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | GDNF |
Synonyms | GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; astrocyte derived trophic factor; ATF1; ATF2; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1 GDNF; ATF; astrocyte-derived trophic factor; HSCR3; HFB1-GDNF; |
Gene ID | 2668 |
mRNA Refseq | NM_000514 |
Protein Refseq | NP_000505 |
MIM | 600837 |
UniProt ID | P39905 |
◆ Recombinant Proteins | ||
GDNF-4835H | Recombinant Human GDNF Protein, GST-tagged | +Inquiry |
Gdnf-250R | Recombinant Rat Glial Cell Derived Neurotrophic Factor | +Inquiry |
GDNF-108H | Recombinant Active Human GDNF Protein, His-tagged(C-ter) | +Inquiry |
Gdnf-249M | Recombinant Mouse Gdnf protein | +Inquiry |
GDNF-109H | Active Recombinant Human GDNF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *
0
Inquiry Basket