| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
26-147 aa |
| Description : |
GP1BB, also known as glycoprotein Ib platelet subunit beta/CD42c, is a member of platelet receptor family. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. This complex is composed of GPIb alpha attached to GPIb beta and non-covalently complexed with GPIX and GPV. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in GP1BB have been associated with Bernard–Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. |
| Form : |
Liquid |
| Bio-activity : |
< 1 EU/μg of protein (determined by LAL method) |
| Molecular Mass : |
14 kDa (131 aa) |
| AA Sequence : |
CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL (determined by Absorbance at 280 nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |