Active Recombinant Human GP1BB Protein (26-147aa), C-His-tagged

Cat.No. : GP1BB-15H
Product Overview : Recombinant human GP1BB (26-147aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability September 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-147 aa
Description : GP1BB, also known as glycoprotein Ib platelet subunit beta/CD42c, is a member of platelet receptor family. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. This complex is composed of GPIb alpha attached to GPIb beta and non-covalently complexed with GPIX and GPV. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in GP1BB have been associated with Bernard–Soulier syndrome, velocardiofacial syndrome and giant platelet disorder.
Form : Liquid
Bio-activity : < 1 EU/μg of protein (determined by LAL method)
Molecular Mass : 14 kDa (131 aa)
AA Sequence : CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280 nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name GP1BB glycoprotein Ib (platelet), beta polypeptide [ Homo sapiens (human) ]
Official Symbol GP1BB
Synonyms GP1BB; glycoprotein Ib (platelet), beta polypeptide; platelet glycoprotein Ib beta chain; CD42c; GPIb-beta; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; BS; CD42C; GPIBB; BDPLT1
Gene ID 2812
mRNA Refseq NM_000407
Protein Refseq NP_000398
MIM 138720
UniProt ID P13224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GP1BB Products

Required fields are marked with *

My Review for All GP1BB Products

Required fields are marked with *

0
cart-icon